DPCstruct | MC48067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 157 ± 9 aa |
| Standard deviation of domain lengths | 9.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6NQ24 | 1-144 | MENRQLTQAEINLLEKQGCRAENWEIITVKPDFNPANIHNVTFAGAVEIGNCCGVQEVKPGCLKNCGIYDSYIRNCTIADNVYIANV… |
| G5AEJ0 | 16-177 | SDHVQYVKARREDFTRSYFPLSAAEIRALEANGNTADDWRDVRKTHEHAPLQTASIRQCSFHGRVALGSFSASYSHDVDGIPFRCGV… |
| A0A024FUA6 | 42-184 | None |
| A0A1V4RI57 | 16-161 | None |
| A0A6L4ZA33 | 19-169 | None |
| A0A496UL60 | 11-162 | None |
| V5WCM9 | 14-179 | None |
| C5K8Q3 | 188-349 | None |
| A0A484DYX9 | 20-182 | None |
| A0A6H5K4J9 | 22-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.