DPCstruct | MC48060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 8.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496X8K5 | 26-96 | MTLFILRDAAGNYLTKELIWVRDCTVAELYKTPHKDIALNQLIELNASDITLRAEVFLCKTDEKNNPVIPD |
| A0A4Y8UL30 | 1-90 | MVAYLLKNIANAYLDKSGEWQTDAPRAAVAQFRHRDEALNLLVELNAKYPDLRAAVIEVQLDDKQRPIFIDDQQPARNHDCIASRFA… |
| A0A3B9AGS3 | 1-79 | None |
| A0A509DXG3 | 3-91 | None |
| A0A3N2DZM4 | 3-78 | None |
| A0A2A5HXA6 | 52-132 | None |
| B8KQL3 | 5-70 | None |
| A0A3S5JUE5 | 1-68 | None |
| Q21EP2 | 2-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.