DPCstruct | MC48053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 159 ± 35 aa |
| Standard deviation of domain lengths | 35.16 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0QCI7 | 23-162 | PITELLAPVPLVLLVLLGINDWVIKPSDAPRWLAGKLSDFTGLAVFPLVATAAFDALLAGLARLGAPVDFTLRRWKLATAIALTGTV… |
| A0A1V4EF29 | 12-173 | AAWLGHPATLAAIAVLLVNDHLLKRLWPGVVTGKLSDVAGMLVAPPLLAFAATLPVRRTVARAPGGTSGSAAVERGEADRRAALAAI… |
| A0A1S9A037 | 11-143 | None |
| A0A7V9L3J4 | 2-154 | None |
| A0A0B5RT02 | 7-283 | None |
| A0A848UEW0 | 1-227 | None |
| A0A4Y3KED9 | 30-184 | None |
| A0A4D7JL06 | 2-244 | None |
| A0A4P2PTM9 | 1-161 | None |
| A0A0Q8CVZ1 | 4-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.