DPCstruct | MC4805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 238 ± 45 aa |
| Standard deviation of domain lengths | 45.32 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 37.87 |
| Pfam Score | 99.15 |
| Assigned Pfam label(s) | PF04227- CL0118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6M6W8 | 9-236 | EIELLGREGHNVTKVSRRDLPFVVAAGKNGATTVASTMIIAALAGIKVFATGGIGGVHRGAEHTFDISADLQELANTNVTVVCAGAK… |
| A0A3M0JQ75 | 33-332 | QSMAREVEEIVRRNGAVPATVGILRGQIHVGLTDEELEFLATSKNAVKVSRRDFPFVLSQGLSGGTTVSGTMIAAHKAGIPVFVTGG… |
| A0A821U1A4 | 9-191 | None |
| A0A354XPM7 | 1-202 | None |
| A0A2G8LCZ5 | 13-275 | None |
| A0A538Q1V7 | 31-297 | None |
| A0A4S4DHW9 | 12-305 | None |
| Q08ZG2 | 3-213 | None |
| A0A842PX38 | 5-194 | None |
| A0A7J7A6L4 | 701-959 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.