DPCstruct | MC48043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 141 ± 20 aa |
| Standard deviation of domain lengths | 19.73 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08315 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q1GHG4 | 114-265 | VGSLQEQALKRKERLKALRDKQLHGRDQEDGEPENKKATLEEPPEEKHRELKLRNYTPEDEELKGRQVPKAKPASVEDKVKDQLEAA… |
| A0A4V3SDI5 | 23-156 | ETEKSVGRLREEALQRKDRLLQLRKRKFKKLGDIGDEDAESDLPKPVFRNYKPQSGDLKSGELPAAPPVDLTPYVTSQLEAANAPVI… |
| A0A7N2MPJ6 | 7-143 | None |
| A0A183B8D5 | 110-256 | None |
| V7CW09 | 5-143 | None |
| D3BSB8 | 178-312 | None |
| A0A7R9UED8 | 3-145 | None |
| A0A5B7DI20 | 43-198 | None |
| A0A0G4HUT1 | 5-124 | None |
| A0A0A0LR08 | 42-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.