DPCstruct | MC48041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 59 ± 9 aa |
| Standard deviation of domain lengths | 8.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 56.44 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | CL0073- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q1G9C5 | 7-56 | SVDGPFLQILEQPKQRGFRFRYGCEGPSHGGLPGASSEKNRKTYPTVKVS |
| A0A671KIQ3 | 7-53 | PYLRIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKNRKSYPQVKVGS |
| A0A6I9YM62 | 75-133 | None |
| A0A4W3HM67 | 1-64 | None |
| A0A1A9VU23 | 2-52 | None |
| A0A140LJD6 | 84-146 | None |
| A0A6I9K145 | 2-53 | None |
| A0A2K5NFI2 | 74-142 | None |
| A0A2K5NFT2 | 77-142 | None |
| A0A2K5QL79 | 95-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.