DPCstruct | MC48037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 213 ± 38 aa |
| Standard deviation of domain lengths | 38.32 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.04 |
| Pfam Score | 68.38 |
| Assigned Pfam label(s) | PF11918- CL0127- CL0079 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G8C8B0 | 8-220 | MLLTAVTHAAHCQTTPAPLPDSVKTFLDKSLTLLETHSLERGTVDWPQLRQTVYQKAQGAQSVRELLPIYPYVFEQLKDDHGWLTYK… |
| A0A2E2XW65 | 272-512 | LPETCGAQDLSGRRATFDVFTSIFERHYAFFERRGVDWQARVAEARARLSDDMSDADVFALLASLIEPLGDSHTKLIAEFDGERHRA… |
| A0A2V3PPM6 | 9-267 | None |
| A0A7X0HLL5 | 1-206 | None |
| A0A2J6TUG2 | 43-268 | None |
| A0A1R3UN21 | 164-347 | None |
| A0A7M1XJN4 | 214-483 | None |
| A0A2A4YSQ8 | 385-587 | None |
| A0A1I0SDU0 | 39-241 | None |
| A0A351T685 | 5-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.