DPCstruct | MC48032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 121 ± 14 aa |
| Standard deviation of domain lengths | 13.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03974 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0MNE5 | 178-287 | GLKRHEFTLPPLENESEKLIDFVINKWMTETCNSVGLDGSIIKKPANGSESTHYVLPSYGITQTLKACTPTSENKELLRVENNNVFS… |
| A0A4V2R133 | 23-155 | SDVAPYPAAGENENRNVIWLDKVENEDNYKVEIIASKQGLRDCNRASYHTDLNRKYLVGWGNDYFVVGKTDLLMSNAMGCVDPKYLA… |
| A8EZM5 | 1-83 | None |
| A0A645G920 | 2-98 | None |
| A0A4Q7VFA0 | 29-155 | None |
| A0A381DH81 | 10-115 | None |
| A0A0N0DQP5 | 10-146 | None |
| S9ULP4 | 9-133 | None |
| A0A0B9H978 | 22-143 | None |
| A0A4Q2ZHR0 | 70-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.