DPCstruct | MC4803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 61.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0JM51 | 1-66 | MPTFPVVVKIGHAHSGMGKIKVDNHYDFQDIASVVALTQTYATTEPFIDSKYDIRIQKIGSNYKAY |
| A0A7J8EMC4 | 93-161 | EMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRIQKIGQNYKA |
| A0A4Z2GLW9 | 64-130 | None |
| A0A2I4B4F3 | 509-577 | None |
| A0A672Q7F2 | 70-136 | None |
| A0A7J8J954 | 93-161 | None |
| A0A1A8GXB9 | 96-164 | None |
| A0A673B9M7 | 241-309 | None |
| T0NQP9 | 8-81 | None |
| A0A6P8UE44 | 140-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.