DPCstruct | MC48026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 402 ± 32 aa |
| Standard deviation of domain lengths | 31.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495W397 | 556-943 | RQSSPFEVGVGVPGRRSEFRGLHAALRDRVGIGGPASALHRAGPGVAQSFRGTSPGHDWVLCAVPDHPPVAVAEPVWEALHVAVLVE… |
| A0A1S2KQN1 | 297-696 | PRTPRIGQGMPERARELRQAHQALAHQGLGEPADEAWEHGTTALQDFHHTDSGEPDWVLCLADDHPPVAVAAPIWQAIIDAGRADPG… |
| L7F5N7 | 3-316 | None |
| A0A229RAV6 | 3-387 | None |
| A0A1C4X335 | 140-579 | None |
| A0A7H8HKI3 | 417-812 | None |
| A0A557ZPH9 | 186-602 | None |
| A0A2I0STD7 | 407-836 | None |
| A0A7W7I7C1 | 305-743 | None |
| A0A5P8K3I0 | 175-574 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.