DPCstruct | MC48019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 472 ± 23 aa |
| Standard deviation of domain lengths | 22.94 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 70.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 49.89 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | PF15628- PF15629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8A274 | 1-501 | MNNMLAERIKEFLNRLVTDHGSIDLEWLRDVQPDKAKDFLLSIRGLGLKSVECVRLLTLHHMAFPVDTNVGRICVRLGWVPLQPLPE… |
| Q9SJQ6 | 905-1387 | MNHKLAERIQGFLDRLVNDHGSIDLEWLRDVPPDKAKEYLLSFNGLGLKSVECVRLLTLHHLAFPVDTNVGRIAVRLGWVPLQPLPE… |
| A0A1D6QN83 | 1404-1906 | None |
| A0A835U6Y5 | 175-650 | None |
| A0A2G2WUX1 | 170-642 | None |
| A0A151TV26 | 546-1011 | None |
| A0A2Z6MQY8 | 280-743 | None |
| A0A067DR76 | 613-1096 | None |
| A0A151QZD4 | 218-693 | None |
| A0A446P9R6 | 179-600 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.