DPCstruct | MC48016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 52 ± 3 aa |
| Standard deviation of domain lengths | 3.32 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 66.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00298 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6UE28 | 1-50 | MRHRSMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGEVEIPSA |
| A0A0K0E113 | 394-448 | KIARTMRPRSMARQLEGTVKEILGTAQSVGCTVDGQHPHDICDAINNGEIKVPEE |
| F1L5Q5 | 1-50 | None |
| S9X6Z3 | 78-132 | None |
| A0A7J9KH35 | 132-186 | None |
| A0A6A6LGM9 | 1-48 | None |
| A0A556TK70 | 99-152 | None |
| A0A7S0FUE0 | 50-104 | None |
| A0A6A6K785 | 1-47 | None |
| A0A2R7WNP1 | 1-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.