DPCstruct | MC48015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3315 |
|---|---|
| Mean domain length (aa) | 201 ± 42 aa |
| Standard deviation of domain lengths | 41.69 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.26 |
| Pfam Score | 94.03 |
| Assigned Pfam label(s) | CL0550- PF02135- CL0110- PF07735- CL0389 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6UBD5 | 26-211 | GAGTIPVPPSNISSDLGCLLKSNVGTDVSFILKGKMIQAHRAVLAARSPVFKAQLFGNMADATASSITLQDMEPATFEAMLAFMYTD… |
| A0A812S9A2 | 790-963 | VPQSTLELWESMRDMTHSHNVIFESSDGEVSAHDQILMAASPVLKAMLASAMKEGTSKRIEVADSTSLGVSLFLDILYTSSTREDPD… |
| A0A2B4SM24 | 37-243 | None |
| A0A4Y7J719 | 542-719 | None |
| A0A4Y7JIL3 | 2-135 | None |
| A0A4Z0YS26 | 188-397 | None |
| A0A0L9UXN4 | 292-481 | None |
| A0A1A9XB14 | 15-180 | None |
| A0A1A9XE35 | 82-191 | None |
| A0A834Y4N0 | 287-421 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.