DPCstruct | MC48012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 78 ± 13 aa |
| Standard deviation of domain lengths | 12.98 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 43.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02234 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835G120 | 1-57 | MPKKAAKRGRQPPPEEVEAFLAAAESSMARRFAAKYNYDVVKDAPMEGRYEWVRVGP |
| B6TQJ0 | 3-81 | AATATAAVLGCSRLQSDIAGAGIPKKGKVGRSPPAEEVEAFLAAAERGMARRFAVKYNYDIVKDAPMDGGRYEWVRVRP |
| D7MXR4 | 1-72 | None |
| A0A287RMU6 | 95-156 | None |
| A0A3L6EJQ5 | 11-109 | None |
| A0A2I0J2J3 | 170-259 | None |
| A0A0V0GRD6 | 53-132 | None |
| A0A540NJW3 | 84-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.