DPCstruct | MC4801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 47 ± 2 aa |
| Standard deviation of domain lengths | 2.23 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 68.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380UTF7 | 170-213 | LEISKREEFYQQEYCGCVYSLRDTNRWRMSNGRDRIKLGVKFYS |
| A0A7X6SUA5 | 6-50 | MIEISKREEFYQQEYCGCIYSLRDTNHHRRQSGREKIEIGVKFYS |
| A0A3S5ES04 | 1-45 | None |
| D0SG34 | 67-113 | None |
| A0A1H7E567 | 94-140 | None |
| A0A484Z4G4 | 1-46 | None |
| A0A776X3U3 | 131-177 | None |
| A0A1E4J976 | 1-46 | None |
| A0A7S2FJ98 | 13-58 | None |
| A0A6C8X8N4 | 104-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.