DPCstruct | MC48004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 4.89 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 45.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02720 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A516NGU5 | 145-224 | VPEETKTEAEQQLARAAVQMPPEYVSKVGHVLLSCLDPDGVLTNDDDRARHRELWVGKQRVDGMSEIKGVLDPQLRALLD |
| A0A0Y1CAQ1 | 1-81 | MDVSTRQAAEADLAGKAAQYRPDELARYAQRVMDWLHPDGDLTDTERARKRGITLSNQQYDGMSRLSGYLTPKRGPPLKPC |
| A0A1Z4ELP9 | 32-111 | None |
| C1B8I7 | 149-228 | None |
| A0A239ZCI4 | 150-228 | None |
| A0A1G4WUG8 | 116-199 | None |
| A0A7G1I720 | 100-172 | None |
| M0QK70 | 2-67 | None |
| R4MDH3 | 1-73 | None |
| A0A498Q9A8 | 13-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.