DPCstruct | MC4800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 207 ± 30 aa |
| Standard deviation of domain lengths | 29.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0472 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519WMZ6 | 12-227 | LRHPKLLKFSKNKLQLRNDFITLLILDFMIAFLVMGTLSILLHYKLIKEYPLIDLTKRFGLLSAGFLICVAAPFLEEGIFRYQLRKR… |
| A0A7X6Q582 | 6-191 | LLILAPIAIVAAEGVDATHRIKFSFILLPLAVLWAPVVEEILFRFNIRRPLLALWMMPVMFFVLLKQGTVIGTLCLILVLAVIMIVY… |
| A0A5E8APG4 | 70-317 | None |
| A0A1H7W742 | 9-221 | None |
| A0A316A4M8 | 1-244 | None |
| A0A6B1GJS6 | 17-262 | None |
| A0A3G6RZD9 | 17-233 | None |
| A0A7X7CZX7 | 6-173 | None |
| A0A651GZV7 | 3-209 | None |
| A0A7C6BVF8 | 5-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.