DPCstruct | MC480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 169 ± 19 aa |
| Standard deviation of domain lengths | 19.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q6ATZ7 | 11-161 | NASPATSALVQRLQPYLHSDAVWTRYQAQKARMWLVYADSERSQRGITNAAAQAEAEAVKLLEQLEQNQAISPTTPIIASSKVLRRD… |
| A0A653L626 | 9-175 | IVGLFMFNGLSSAMAEQSIKPISQVQQLAQQVEAELHGTDPLLRYHAYKAKVWLSYAKSEISAQGLSSAGQEALQQAQILVDGFNQP… |
| A0A2M9TVI8 | 174-343 | None |
| A0A1Q8DXJ9 | 20-253 | None |
| A0A378QLX6 | 52-227 | None |
| A0A1H4GH14 | 63-229 | None |
| X0RC47 | 1-161 | None |
| A0A373BC03 | 12-180 | None |
| A0A1N7SEH2 | 60-214 | None |
| A0A4Q6EF30 | 44-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.