DPCstruct | MC48
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Standard deviation of domain lengths | 8.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 26.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S2HXN8 | 69-132 | TEEPRVPMTWARPDSGLWVANYGGYYGGTVDRQGTHFFVADTFGQYVGDFRTLDEAKARLLERL |
| A0A2W0CQR6 | 1-59 | MQWTSPEDGFWLARVDGVLAGQVDRHRHGYLVTDAHSRWVGDYRDLGTAQQQLRRSLDG |
| A0A506Y4L9 | 1-93 | None |
| A0A506Y5Z4 | 85-146 | None |
| A0A2T7W1B2 | 1-79 | None |
| A0A521MSW4 | 2-65 | None |
| A0A7J5BQ76 | 7-84 | None |
| A0A7X6KXI7 | 6-83 | None |
| A0A2A4EB34 | 18-81 | None |
| A0A4R8V9P9 | 5-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.