DPCstruct | MC47990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 277 |
|---|---|
| Mean domain length (aa) | 85 ± 13 aa |
| Standard deviation of domain lengths | 12.54 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.70 |
| Pfam Score | 83.55 |
| Assigned Pfam label(s) | CL0023- PF00571- CL0428- PF04972- CL0232 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A085ZEE5 | 15-87 | EQVIKAEKAFFISQDISEKIIDTFNVCNLRVSATADGTVSISGIVDNDNEKRDIQNFVLQLESVSSCYNGLEI |
| Q2L114 | 21-106 | LAHAAEAQPKQSVGEYASDAAITAKVKAAIVADKDLSALDIAVETNNGVVTLTGTVGTAFQADRAAIVTRGVDGVKQVKNDVKVEM |
| A0A829XWR2 | 71-157 | None |
| A0A1G6RDL4 | 2-106 | None |
| A0A1V1V479 | 14-95 | None |
| W6W3Q6 | 10-88 | None |
| A0A7C3MSY5 | 346-425 | None |
| H2FX49 | 39-137 | None |
| A0A535A1H4 | 91-167 | None |
| A0A840I365 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.