DPCstruct | MC4799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 136 ± 10 aa |
| Standard deviation of domain lengths | 9.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 25.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P1MHZ0 | 2-121 | IREKAEAEASARRQQVYEKLPEIKQIDEEVRELGMRLSRIMVSGADNAKEQLGRFRIKIDALGEEKAFKLTENNFPVDYMEIRYKCD… |
| A0A7X6PKB3 | 33-161 | VSRKVLNDYFEYIRGEEEEALKDRIREVRRNIPEMEKVFADEKELNAKLLSIKPGEGSREARERLKAERRDAGERKKDLLTGAGYPE… |
| A0A143XKT2 | 9-133 | None |
| A0A1Q6SBC1 | 1-148 | None |
| D4MPA7 | 1-144 | None |
| A0A7X7L6W9 | 153-269 | None |
| A0A645JPI1 | 7-143 | None |
| A0A1E4LFR6 | 262-393 | None |
| F5T6X6 | 1-147 | None |
| A0A6N9QC19 | 54-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.