DPCstruct | MC47984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 11.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B4M9A7 | 2-86 | RQQNVEHLGQVRTALLESDGILSLLYYEDEDVKWGLPLFPDAYRKAEVLKINTFYSCMKCGETKILNKLDQECSRCHHHSWAESL |
| A0A3F2TZR8 | 6-102 | LSRNELFQQLREHGVEHLGEVAHAYIETDGALTVFKAKESRPGLPIVPPWEIEPPTEVKATQTAGRDSLVCKQCGTTADRDRSTCLN… |
| A0A6N4ABK1 | 100-203 | None |
| A0A6J4KEA1 | 169-284 | None |
| A0A3N7IW31 | 21-119 | None |
| A0A521BB02 | 112-230 | None |
| A0A5M6DL62 | 130-236 | None |
| A0A2N2ZXA2 | 52-150 | None |
| A0A069PD11 | 15-113 | None |
| A0A4Q3CP95 | 79-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.