DPCstruct | MC47982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 207 ± 22 aa |
| Standard deviation of domain lengths | 22.48 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.01 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | PF14648- PF14647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R9B5C4 | 1-176 | VNIDVEFHIRHNYPWNKLPANVRQSLSGDSSSWRSSSLSSHQKDERRYYEELLNYSRDHLMMYPYRLLDIMVKGLKITPFSYYTGIM… |
| A0A480IVM1 | 1-227 | MNIDVEFHIRHNYPWSKLPANVRQSLGNSQREYEKQVVLYSIRNQLRYRNNLVKHVKKDERKYYEELLRYSRDHLMLYPYHLSDIMV… |
| A0A6L5D3N8 | 7-175 | None |
| G0NCG8 | 3-224 | None |
| A9V2F8 | 6-230 | None |
| A0A5J4W7B8 | 7-191 | None |
| A0A7J0EHB6 | 16-203 | None |
| A0A4V3WQC9 | 115-289 | None |
| A0A3Q0IMV8 | 5-234 | None |
| A0A5A9NQJ8 | 1-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.