DPCstruct | MC47981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 83 ± 10 aa |
| Standard deviation of domain lengths | 10.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H1SIB8 | 43-115 | DEPEPGRWRLVDSIGREYGRVTIVRVDGEVRYRAEFEGVLLGWGTTLRGACERVHRAFVRSHGPGDWQGYPDF |
| A0A7L8D3H8 | 1-93 | MGTWHPILAAHEYAPGEWIMVDPSAKPYAVVRALELGGERGYRVVTWAERSEDRQLVGYWQTLRAACAASHRRYLAQHGPGDFAGYP… |
| A0A852X2Y8 | 2-70 | None |
| A0A191WF67 | 1-78 | None |
| A0A2U1SYA1 | 29-106 | None |
| A0A4S4FTD6 | 2-85 | None |
| A0A1Y5P0X2 | 1-104 | None |
| A0A0Q6XVN2 | 1-81 | None |
| A0A1R3W497 | 232-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.