DPCstruct | MC47977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 198 ± 44 aa |
| Standard deviation of domain lengths | 43.95 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 75.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 27.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0S747 | 8-174 | PPGRWAFLYPWCRVLRHKLNLEGQTAENSARWEYHSVEVRLPHAPDKADVHALRRIREALDLLARVALVDNAAWRVLLQQQCRVARD… |
| A0A6A3KF16 | 2-148 | AMEQRWGFLASWCAALKRHVSYTSMRSDHEGREVSIRYFRVTIPPRDEFNGDEILYQAKLQQIREGLALLVAVKHVDEAAWRFMLVS… |
| A0A225WQ92 | 4-211 | None |
| A0A662YH59 | 2-210 | None |
| A0A5D6XS53 | 8-210 | None |
| A0A081AVI1 | 2-142 | None |
| G4ZFE7 | 2-201 | None |
| A0A6A3U8L5 | 46-259 | None |
| K3WVG4 | 4-272 | None |
| D0N0X7 | 1-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.