DPCstruct | MC47965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 212 ± 26 aa |
| Standard deviation of domain lengths | 25.75 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 20.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0JF69 | 40-266 | LKIVVEALRLLVGDNSDIEKIRNRAMLLQEKMQQQQDAAKQEELEKKAKEEFGKYIENGTIDAMSIKRDSNSDLLYTIIKLKEDNKS… |
| A0A7Y6JT69 | 341-505 | YKELQPEVQPQIEKQLEEWKKAGANAAQRGSVIGVEIDNKTVFTEYSKDSIIETAKVLEGIDPNIGLGSHIIKVGGGEVEIRKEEGD… |
| A0A5E4N097 | 126-343 | None |
| A0A5C4TMY1 | 273-490 | None |
| A0A3B0IVF1 | 243-435 | None |
| A0A6M5EA83 | 5-231 | None |
| A0A482XIB0 | 83-270 | None |
| A0A7L7YPV0 | 194-460 | None |
| A0A7L7YQ33 | 210-419 | None |
| A0A7M3U2S9 | 30-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.