DPCstruct | MC47964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 128 ± 15 aa |
| Standard deviation of domain lengths | 15.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0IXK7 | 1-145 | MRITRNFAEKILDFLLPGQDHVIALHNNHNSPSYSFKSYFSPPLSHDVLKIYPEVCPENGTGEFFYTTDEGWFNALKQKEIFNIVLQ… |
| A0A7Y5LG46 | 136-237 | GLLIALHNNRETYSVQDEVPISDRVSLKAPASPREFLLATDPRDFEILSASPFNVVLQNTPAGEDDGSLSRWAAREGVRYVNIEAAL… |
| A0A3L7SKC3 | 125-256 | None |
| A0A2G6PWJ8 | 119-267 | None |
| A0A1N7EHJ6 | 146-292 | None |
| A0A2N9XK80 | 1-117 | None |
| A0A4R3KQ92 | 142-274 | None |
| K2FB75 | 296-409 | None |
| A0A2E6SIN7 | 504-615 | None |
| L0D5J2 | 329-460 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.