DPCstruct | MC47963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 113 ± 19 aa |
| Standard deviation of domain lengths | 19.29 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0392 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4S5M0 | 12-81 | GDLKGPWAIGGFQARMDRREAKDILGLKESQVTKNRLKDAHRKIMLANHPDRGGSPYLASKINEAKDLLE |
| A0A7S4NIP1 | 10-116 | NTMAGFGRLLANLIVMGGGVMTRAFVEAYKQALANGGQAAAGAAKTAARGGIAEAEARMILNVKPKATEAEIMEAHEKLMGMNDPAK… |
| A0A6A5DIS2 | 85-211 | None |
| L8Y9D9 | 15-103 | None |
| B6JYD7 | 7-108 | None |
| A0A4S4DB67 | 258-365 | None |
| A0A445CJ65 | 22-134 | None |
| A0A852XRM4 | 3-93 | None |
| A0A811MII6 | 336-437 | None |
| A0A182FSF9 | 2-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.