DPCstruct | MC47961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 12.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4N5I3 | 1-121 | SSVVITGGSKEEAVLRTALASKDEQDADVYFVLKTLTRNKVEREIGQGYLNLQSMLRDGRDVTSASVDLRAQGMESSAGALMVSFVA… |
| A0A8B6DC42 | 1-81 | IRFTVVSEPPDDDDEGECEDIGIAFVSVRDILINHKDVIDHDIPIFDANNEKEEIGSLNVTVQCLSALEAVEKEMQIDGTF |
| A0A0L8IAY5 | 5-90 | None |
| A0A1A8K392 | 875-978 | None |
| A0A3Q2XD25 | 276-378 | None |
| A0A0M0K6Z8 | 63-184 | None |
| A0A834BPA1 | 429-509 | None |
| A0A3Q3WLS9 | 546-648 | None |
| A0A814G5S4 | 1-92 | None |
| A0A3B4VK57 | 273-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.