DPCstruct | MC4796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 146 ± 7 aa |
| Standard deviation of domain lengths | 7.35 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A590UK67 | 1-142 | MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFRLFQLELEADALVNFHQY… |
| A0A6D2XH89 | 1-151 | MQFFGRLVNTFSGVTNLFSNPFRVKEVAVAHYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFRLFQLELEADALVNFHQY… |
| A0A3P7EAG6 | 21-168 | None |
| A0A232F9X4 | 4-144 | None |
| A0A443SKE2 | 7-143 | None |
| A0A0P4W3B0 | 1-143 | None |
| S9YLV5 | 135-276 | None |
| A0A0N1INE0 | 411-555 | None |
| A0A3P7LP70 | 1-152 | None |
| A0A5S6Q2I8 | 17-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.