DPCstruct | MC47957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 536 |
|---|---|
| Mean domain length (aa) | 220 ± 33 aa |
| Standard deviation of domain lengths | 33.01 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 14.11 |
| Pfam Score | 71.97 |
| Assigned Pfam label(s) | PF20478- PF06002- PF01973- PF00777 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0WB72 | 1-220 | MKKPLIIAGNGPSIKDLDYSLFPKDFEVFRCNQFYFEDKYYLGREIKGVFFNPCVLSSQMQTAQYLMDNGEYSIERFFCSVSTDRHD… |
| A0A384D8L2 | 2-170 | NSQLVTTEGRFLKDSLYNEGILIVWDPSVYHSDIPKWYQSPDYSFFENYKSYRKLHPDQPFYILKPQMPWELWDIIQEVSPEEIQPN… |
| A0A4Q2XI68 | 11-230 | None |
| A0A450T0F7 | 44-301 | None |
| A0A0T5P6M3 | 424-650 | None |
| A0A7X2D1G3 | 177-410 | None |
| A0A5Q4ENT3 | 503-739 | None |
| A0A0A0DW40 | 49-328 | None |
| A0A7M7HNA0 | 250-486 | None |
| A0A7M7N659 | 2-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.