DPCstruct | MC47950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 111 ± 18 aa |
| Standard deviation of domain lengths | 18.07 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08859 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q1CGD9 | 9-115 | VYSCSGCSSAAQMANHLAIKLDRSGKAEMSCIAGVGGNVKALVKTAKSSRKIIAIDGCPLACVKACLSNHNIKADQHFELSGYAVKK… |
| A0A7T2TZJ0 | 7-126 | ALPIVYSCSGCSNVAQLANHVAVRLDRGGDAEMSCIAGVGGDVPSLLRVAHSGRLILAIDGCPLVCAKKSLARHGIAPDAHLQLGEH… |
| A0A1H2BFM5 | 16-137 | None |
| A0A843B4C2 | 103-216 | None |
| A0A1V5ZSD6 | 3-99 | None |
| A0A661ZNC9 | 103-193 | None |
| A0A497FA68 | 2-96 | None |
| C6C084 | 13-145 | None |
| A0A840V531 | 2-114 | None |
| A0A6I3BUB9 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.