DPCstruct | MC47947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 336 ± 71 aa |
| Standard deviation of domain lengths | 70.78 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07906 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A827D276 | 20-384 | KEKEFPRIKLNGQCYFPGRPQNRIVCRHIAAQYINDIYQNVDYKPHQDDYSSAEKFLTHFNKKCKNQTLALVSSRPEGRCVAACGDF… |
| A0A081KB19 | 101-495 | RSVECRLVFSGDHVGLLPSYRSKDEPAAYLNCIVMWPGKTDKDDVIACRNLAQAYTDRTFGRGKSSFLQVDSPFKLQALAAQIPDDK… |
| A0A3G5KE23 | 21-454 | None |
| A0A1C9VIH4 | 163-555 | None |
| A0A271RAW0 | 30-437 | None |
| A0A410UED0 | 154-487 | None |
| A0A410UJ87 | 207-610 | None |
| A0A1X3LQY3 | 2-387 | None |
| A0A1G0Z201 | 154-454 | None |
| A0A1Y2QFU9 | 187-654 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.