DPCstruct | MC47940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 271 ± 36 aa |
| Standard deviation of domain lengths | 36.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383W3L8 | 2-260 | CTYLASKKEATAVNVQLIGIVSNVVVLSQLWYAQVMPLQAFAGVLAASVAISVASLLYSRGKMTDRSWLPFEALVGAVGVGAAPQVL… |
| A0A2I4F906 | 18-290 | ALLAVPWLGMFTGLLGNLSLLSYFTKKKENEVIVVQTLGVLSQYVVFAQLALAEAMPLPYFVVTSVVVAAGLILNFMNYFEWLNSGL… |
| A9RKA4 | 12-270 | None |
| A0A5J5BBX4 | 451-743 | None |
| C1EHB4 | 20-351 | None |
| A0A199VEX1 | 6-247 | None |
| A0A1F9U6L7 | 489-763 | None |
| A0A383VPH4 | 2-325 | None |
| A0A6N2M7D4 | 2-195 | None |
| A0A7J6HUR6 | 4-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.