DPCstruct | MC4794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 5.50 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 69.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V7BPB0 | 1-79 | MNLFLKHEVKENDGRYEAILFLNKKNVDHLNENVFHLAIKKEALSYVKSKFTSVPIEVVRIMIGSFLYFSFAVNIKRDV |
| A0A3D5KEV9 | 3-78 | FSSYKLMEKGDGYDIVLYLDECSVKFSPDLLNSKNKERQSIIKQGRNYLKKVLPNVRINNLTIMHGSFVIYQIAFS |
| A0A4Q0VNE5 | 9-88 | None |
| A0A1I0D5J4 | 3-87 | None |
| A0A4S3PKU8 | 1-83 | None |
| A0A4U7JCM2 | 1-85 | None |
| A0A511W361 | 1-83 | None |
| A0A2N6RQZ1 | 1-74 | None |
| A0A0A6V9N9 | 1-87 | None |
| N0AVB4 | 3-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.