DPCstruct | MC47939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 264 ± 46 aa |
| Standard deviation of domain lengths | 45.90 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.67 |
| Pfam Score | 98.46 |
| Assigned Pfam label(s) | CL0512- CL0021- PF08588 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383W2N9 | 14-254 | QHEIPINQGPVTINSAFFEGIMEIHLKGLPNSQQRLFEGKKRFFQIMCQGRFKRPVPASSLCMGQEFVKPGNAPPWVGELVMTAAAK… |
| A0A139HX65 | 28-303 | LLVTAGPSYNLSTHKTVKVNTEEATYIQNKFLRAKIQVRIRGYRGLPSSSPSESSYFNDPIHRNDQYSVGFSFVPKLDIPSKDTVWG… |
| B6K290 | 10-248 | None |
| A0A7S0ACM8 | 13-291 | None |
| A0A812XS85 | 70-337 | None |
| A0A061R667 | 67-318 | None |
| A0A3N4KSK1 | 13-292 | None |
| A0A0M8N1R3 | 16-260 | None |
| A0A7J6L6J7 | 55-334 | None |
| C1ECU0 | 360-595 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.