DPCstruct | MC47932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 167 ± 23 aa |
| Standard deviation of domain lengths | 22.74 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 19.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W2EBF3 | 17-186 | SPVPELNELAELQKQVGAEYLSRCFEPLPEYDDKMSFEAVDLTDPDFLSRVVVFAMANGSGSHYGFWRVDDREDLATLPVVAFGDEG… |
| A0A2G6UNN3 | 65-235 | GSTAVPTELEKLIDFQTNISAPEFYSQGFAVTIDDKGGLISWSNNPSFIDKLHPFAQANGTGSFYAIWNDGTSKPINEMPIVVFGDE… |
| A0A1R3UTN5 | 180-371 | None |
| A0A530BQJ9 | 2-187 | None |
| R6WB80 | 3-164 | None |
| A0A4Q1ES17 | 3-125 | None |
| A0A1R4FKE6 | 10-204 | None |
| A0AFQ3 | 500-698 | None |
| A0A0B8T378 | 8-147 | None |
| A0A318UEB8 | 126-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.