DPCstruct | MC4793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 119 ± 21 aa |
| Standard deviation of domain lengths | 20.81 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10844 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318MJI4 | 8-116 | KDSDYADVVYGVVISTEPLKVQLSNNMVIDDNFIILGKHIGKFKLPGKATIEVQSHGDQIGNVSGNRPTVSEKITFKEMEFDNSLKK… |
| A0A3D4FKR4 | 1-117 | MKLSDCYGEFIKLIRDQGKYFNPPSVELGEIISTSPISIKTSDITLSKENLYISEHLLKDNIEISFNGEVKIEGSAKNVSIDKKKID… |
| A0A369Y132 | 4-140 | None |
| A0A0Q3QVM9 | 2-99 | None |
| A0A173SMI4 | 1-141 | None |
| A0A6L2ZYA3 | 10-121 | None |
| A0A316LP17 | 28-158 | None |
| A0A316PDH8 | 9-137 | None |
| W8T6A0 | 68-192 | None |
| A0A849D0V2 | 2-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.