DPCstruct | MC47927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 465 ± 55 aa |
| Standard deviation of domain lengths | 55.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2GWN1 | 1-534 | MDATLTPKQKKRLHEVADLMLQIFQTLARMRYLEPEWIEPGPHDISALMPLYKSLNIDPAIIYLYSILPYLNEAAYRHGVDFYGGGE… |
| A0A4Z1HP45 | 21-397 | QQEIVTLITQYYELLAKMRDFPASYIKYAPYDPPIDVDLAKSFDLEPQVIELLQALPYIEGYSNEDEFILGGSFADMRDLEVLMQSR… |
| A0A6A5WGF7 | 75-591 | None |
| A0A0A1TKU6 | 1-459 | None |
| A0A4Q7KAK8 | 1-417 | None |
| A0A545UZ09 | 12-541 | None |
| A0A6A5Y8K8 | 72-497 | None |
| A0A6A5SXB6 | 63-562 | None |
| M3CR00 | 54-519 | None |
| E9EE17 | 31-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.