DPCstruct | MC47922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 234 ± 27 aa |
| Standard deviation of domain lengths | 26.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.22 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF00384- CL0199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z7IYV5 | 15-254 | MSRTGRVAAAFAHSPEPTLRMHPGDAQRRGLVAGELVQIASKRGALVLPLELSDELRSGTVFAPMHWSGQSLSSGGINEVSTPAVDA… |
| W7WCP6 | 591-836 | VSLTTGRLRDHWHGMSRTGTLGRLFGHVAEPGVEIHPRELVRRGWEEGALVHVTSRRGSVMLPVRASDSVAPAQAFVAMHWGEEFVS… |
| A0A0Q0E194 | 356-599 | None |
| A0A7C2YCB3 | 695-890 | None |
| A0A447LQ94 | 222-398 | None |
| A0A2W4MAK3 | 157-371 | None |
| A0A2P5NVI6 | 1-267 | None |
| A0A3E1RA76 | 226-490 | None |
| A0A5C7N2P0 | 619-879 | None |
| A0A5A9GGA0 | 651-867 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.