DPCstruct | MC4792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 253 ± 54 aa |
| Standard deviation of domain lengths | 53.69 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.61 |
| Pfam Score | 87.14 |
| Assigned Pfam label(s) | PF01973- PF20157 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D4FJS1 | 43-277 | LIKGKDTVVIYGLALGYHIKSILKNANKNSKIYIFDLDSEVVQIGKKLKVYDEILLDKRVEIFTEFNEEFNIVFSNLLNKVEDIIIY… |
| A0A826FT67 | 65-348 | LNSMLNTYNDKYLLYPVLYFYGFGNGILFKALLQNKNHQHIVVFEKDIEIIWIMFHILDFSNELQSARLMVLQTSSLDIEFFSNFCS… |
| A0A0A0DW40 | 3-171 | None |
| A0A265QB13 | 5-178 | None |
| M1PJ97 | 570-818 | None |
| M3E237 | 69-313 | None |
| A0A327X5W7 | 390-652 | None |
| A0A850SXS3 | 82-329 | None |
| A0A6M1YJS4 | 69-273 | None |
| A0A7C5WDA8 | 1-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.