DPCstruct | MC47911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 12.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A450SPU1 | 203-302 | DDCKREFAYWQTKAEAANTGYLDPNNPRYAPKLAAAVRAWQAVTNPGRRSPKKALEEWLREHAMEYDLIHPDGKPIELAIDDCAKIA… |
| A0A653JPF7 | 31-142 | TTVLVADIRTWLSGRSIKTGFFFPENADQPDYLDPQHPRYAPKLAATVRAWLAVEDPMGKHPKQALMKWLRVHGAEYGLLDDEGKPN… |
| A0A522EFI8 | 2-114 | None |
| A0A2R7MXJ4 | 48-173 | None |
| A0A370NFV0 | 118-228 | None |
| A0A5P9F9J2 | 170-279 | None |
| J1IZ67 | 10-100 | None |
| A0A2M9E491 | 1-131 | None |
| A0A2I1RJK0 | 114-216 | None |
| A0A2E4S6W4 | 121-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.