DPCstruct | MC4791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 5.98 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 24.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212KNW8 | 116-202 | TIVTESKVGQIIGGSSKAATLIKSFAIGNKRQRETSVEVESESGIVEAEIVYSEVKVKVHEASELITKENKQIRYTAEGKRLISEHF |
| A0A3D4FGV2 | 1-91 | MDSVYFVADRSTTRGGIINAADEIKCKIVGTIAGVSTILKVKKSGHIHADIAYYNTKFIIGEKEFLLEEPSRNIHVYLDNDKELVVD… |
| A0A357TAZ9 | 119-200 | None |
| A0A3B9UX23 | 743-833 | None |
| A0A4Y8L5L0 | 629-708 | None |
| A0A3A6N170 | 511-592 | None |
| K6QCB1 | 715-793 | None |
| R6FRX6 | 91-180 | None |
| A0A7C6I3U1 | 94-168 | None |
| A4INM2 | 3-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.