DPCstruct | MC4790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 304 ± 35 aa |
| Standard deviation of domain lengths | 35.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0V0S2 | 3-286 | KYVVSEDLELVLKQLVTVNGFSLPSEDTIADLRSGLKWQLQKIFGINAVEVITAAHIRDGIREMVEQSDLAPVSLDRLYMQCERHID… |
| A0A3D3TQL5 | 109-446 | GSKNKESPVLAVNMTSPCILNLDVENILKEPFRSNSKIKNVINSRRKLLQGALSKLYPNELLLCFNSEVLHQKMIRNICHENSISTY… |
| A0A7U4JQF6 | 942-1259 | None |
| A0A0W0YB16 | 782-1110 | None |
| A0A7T5UHQ1 | 12-388 | None |
| A0A439UHY2 | 2-247 | None |
| A0A497ICQ0 | 59-313 | None |
| A0A7C7E626 | 395-683 | None |
| A0A0G1SFI6 | 11-351 | None |
| A0A6A6TMQ9 | 235-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.