DPCstruct | MC479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 114 ± 8 aa |
| Standard deviation of domain lengths | 7.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T3M9E3 | 1-110 | MDLKDFIDQTLDQITEGVFVAQEKVRARGGFVNPALRDSASVQAMHCGHTIQSVSFDVAITVQEDSSNSAGAKLSVASFFKADGEVL… |
| A0A6M1NAT4 | 1-115 | MELSEYINDTILSVVEGIEQSQKQLSDKGSNAIVNPSITSVGDVKFIDDRAGKRAVQEVNFTIGITIEGESESEGGGGVKLSVFQAG… |
| A0A127CGM0 | 14-125 | None |
| A0A6A2GTL9 | 1-113 | None |
| A0A1Y4D3U9 | 1-121 | None |
| A0A097EPT3 | 1-132 | None |
| A0A0G0HNY9 | 1-98 | None |
| A0A4P7HKE6 | 10-128 | None |
| A0A7W9JUJ2 | 46-160 | None |
| A0A4R2LN16 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.