DPCstruct | MC47898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 110 ± 11 aa |
| Standard deviation of domain lengths | 11.07 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 55.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534LJW5 | 286-394 | AVVTVMTAPHGCPHGVCTYCPGGPRFGTPQSYLGTEPAARRAADYHYDPRGQTAARIEALQRIGHDTDKVDLIVLGGTFTALEAGYR… |
| A0A1E5V126 | 10-106 | AAPEQPRRRKPAPGRGGVVLPAGLSEEEARVRAIAEIVYNPYVQARSRIDQLKRLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLH… |
| A0A7J5YJ55 | 95-195 | None |
| A0A4C1TFV0 | 1-107 | None |
| A0A1R0GUE2 | 396-512 | None |
| A0A2G2X857 | 106-223 | None |
| A0A2K1IS67 | 93-170 | None |
| A0A0R3TD52 | 91-208 | None |
| A0A7I8XDV9 | 284-401 | None |
| A0A0M8MY17 | 78-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.