DPCstruct | MC4789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 3.73 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K4ZKY1 | 15-72 | GYAMMPMRKNIPVGRDGWELTQCPACGCECWKTPLLSVVLQQGATALCTECALRKGVE |
| N9VBM4 | 3-66 | KIGIACMPLVGNIPKPHGSGQWSKTKCPVCGRECWETNQFKWAKQAGIVNEAACTECALKGCSE |
| I0BHQ1 | 1-61 | None |
| A0A1T5KXW5 | 74-133 | None |
| A0A4R3TFF6 | 1-57 | None |
| R7NA59 | 14-74 | None |
| A0A3Q9HSW0 | 1-57 | None |
| A0A1V5C013 | 133-203 | None |
| F4XCQ7 | 195-255 | None |
| A0A1Y4UTU1 | 2-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.