DPCstruct | MC47885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 141 ± 17 aa |
| Standard deviation of domain lengths | 16.68 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1PJG9 | 129-277 | APVPLCWAATTLRQPYANLGDALSPVIVSALSGLPIVHQRFDSSTERLASVGTIGHGLKNGSVHLWGTGIDGKRHPFHRHLTYYERP… |
| A0A1H4GYP1 | 1-136 | MLLHKKADEIVLNVSMNLLCNKVFHSNIGDDINYYLIKELSHKRILNYWDFFNLRKQPNFMVIGSIIGWMTNKDSIIWGSGVREPDN… |
| A0A543A1Z6 | 18-151 | None |
| A0A430KN47 | 69-185 | None |
| A0A395YFR2 | 1-171 | None |
| A0A2M9CDP8 | 125-251 | None |
| A0A7W9V898 | 2-127 | None |
| A0A6C0BN66 | 218-381 | None |
| A0A1Q9V0J4 | 273-426 | None |
| A0A7W5F9Q7 | 502-635 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.