DPCstruct | MC4788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 145 ± 22 aa |
| Standard deviation of domain lengths | 22.42 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 48.55 |
| Pfam Score | 87.53 |
| Assigned Pfam label(s) | PF02772- PF00438- PF02773 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834QDW8 | 207-399 | QGVHLDRNEEDIGAGDQGLMFGYATDETEECMPLTIVLAHKLNAKLAELRRNGTLPWLRPDSKTQVTVQYMQDRGAVLPIRVHTIVV… |
| N9UYV9 | 1-106 | MFGYACYDTDVLMLAAIYYANALAKKLHDASCKNNILQHDAKTQATVSYENGKFKDITNIIISTQHIVSASQKEIENLIINDVIKKT… |
| A0A183J7P4 | 126-290 | None |
| F0WA18 | 118-278 | None |
| A0A507FFG9 | 381-515 | None |
| A0A5N5MBB6 | 842-973 | None |
| A0A812UYI2 | 130-249 | None |
| A0A5E4BJZ2 | 226-343 | None |
| A0A4W3JFH1 | 118-249 | None |
| A0A1I8AGJ1 | 86-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.