DPCstruct | MC47875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 106 ± 9 aa |
| Standard deviation of domain lengths | 8.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6R2V2 | 90-200 | ALRRFKYRHLLRIGARDLLGDADLAVTTEELAHLADACLAEALVFTESAARVDYGAPLDPSGAETGVAVIAMGKLGGEELNYASDID… |
| A0A2X5S9W0 | 1-109 | MLVRIAWMQTLSLAGTEQSLRQLSELAEVLIVAARDWTYRQCCLEWGTPCNADGKPQTLYILGMGKLGGGELNFSSDIDLIFTWPEN… |
| A0A336N8Q8 | 205-304 | None |
| A0A4Q1B4S8 | 47-155 | None |
| G2DCD9 | 104-205 | None |
| A0A2G6EG23 | 133-243 | None |
| A0A2X3FDA0 | 87-198 | None |
| A0A259KD15 | 89-184 | None |
| A0A0M1J303 | 96-185 | None |
| A0A533X9K7 | 164-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.